PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN26661.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 270aa    MW: 30869.9 Da    PI: 9.4299
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN26661.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.77.5e-151562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd +l + + ++G g+W++++ + g+ R +k+c++rw +yl
       KHN26661.1 15 KGLWSPEEDNKLRNHILKHGHGCWSSVPIKAGLQRNGKSCRLRWINYL 62
                     678*******************************************97 PP

2Myb_DNA-binding55.99.9e-1868113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++++E+e ++ ++++lG++ W++I+++++ gRt++++k++w++yl
       KHN26661.1  68 RGKFSKQEEETILTLHHMLGNK-WSRISQHLP-GRTDNEIKNYWHSYL 113
                      89********************.*********.************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.5E-221065IPR009057Homeodomain-like
PROSITE profilePS5129417.8631062IPR017930Myb domain
SuperFamilySSF466892.32E-2812109IPR009057Homeodomain-like
SMARTSM007172.8E-111464IPR001005SANT/Myb domain
PfamPF002492.8E-131562IPR001005SANT/Myb domain
CDDcd001671.66E-91862No hitNo description
PROSITE profilePS5129426.0763117IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-2566117IPR009057Homeodomain-like
SMARTSM007172.2E-1667115IPR001005SANT/Myb domain
PfamPF002496.6E-1768113IPR001005SANT/Myb domain
CDDcd001673.94E-1170113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MGYQPLEKGK PKHKKGLWSP EEDNKLRNHI LKHGHGCWSS VPIKAGLQRN GKSCRLRWIN  60
YLRPGLKRGK FSKQEEETIL TLHHMLGNKW SRISQHLPGR TDNEIKNYWH SYLKKRVAKA  120
KEMESHNQIK YASSSSDTMD SSHSLQNLAT QCPLNYNFTK EASQSSLPKL LFAEWLSLDH  180
LNSANSVDSL GLRNGFDQNS SFHEAAIHDM SEVPFGGEYN RCVSNISAPE MFNSQLKYGN  240
QMVENGYIHC MPRVDLSSNF SISNDAIMYI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-221111723128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0977340.0BT097734.1 Soybean clone JCVI-FLGm-16G14 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003556102.10.0PREDICTED: transcription factor LAF1
SwissprotQ9M0K42e-59LAF1_ARATH; Transcription factor LAF1
TrEMBLA0A0B2QYB60.0A0A0B2QYB6_GLYSO; Transcription factor LAF1
STRINGGLYMA20G29710.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38303161
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G48920.13e-62myb domain protein 45
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]